Welcome to Astor Scientific. Contact us: info@astorscientific.com

New collections added! Learn more

GenDEPOT  |  SKU: L0011-010

LucyQ Gaussia Luciferase Assay Kit

$191.00 $219.00
Shipping calculated at checkout.


Care information

Display general product information or specific product information using metafields.

Delivery and Shipping

Add some general information about your delivery and shipping policies.

Payment & Security

Payment methods

  • American Express
  • Apple Pay
  • Diners Club
  • Discover
  • Google Pay
  • Mastercard
  • PayPal
  • Shop Pay
  • Venmo
  • Visa

Your payment information is processed securely. We do not store credit card details nor have access to your credit card information.


Product Description


Product Reviews

GenDEPOT

LucyQ Gaussia Luciferase Assay Kit

From $191.00 $219.00
LucyQ Gaussia Luciferase Assay Kit contains reagents for measuring Gaussia luciferase activity in mammalian cell culture media and lysates. When used with Gaussia Vectors, the kit provides an extremely sensitive bioluminescent reporter assay system for secreted or intracellular detection of luciferase activity with extended signal stability. The light output generated by the luciferase reaction can be correlated to the amount of luciferase protein produced, which in turn is proportional to the activity of the promoter driving the luciferase expression. The kit can be used to detect the activity of any Gaussia luciferases or derivatives that use coelenterazine as a substrate.

Store at -20℃

GLuc-M2 sequence KPTENNEDFNIVAVASNFATTDLDADRGKLPGKKL
PLEVLKELEANARKAGCTRGCLICLSHIKCTPKMK
KFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPGFK
DLEPLEQFIAQVDLCVDCTTGCLKGLANVQCSDLL
KKWLPQRCATFASKIQGQVDKIKGAGGDGSLSTPP
TPSPSTPPTGLNDIFEAQKIEWHE
Gluc-M2 For optimal results and a long lasting glow kinetic please use following Gaussia-M2 sequence
(Welsh et al. , Multiply mutated Gaussia luciferases provide prolonged and intense bioluminescence,
Biochemical and Biophysical Research Communications 389 (2009) 563–568)

Size

  • 100 Assays
  • 1000 Assays
View product